grant

The mechanism of cell size regulation by polycystins

Organization UNIVERSITY OF TOLEDOLocation TOLEDO, UNITED STATESPosted 15 Apr 2022Deadline 31 Mar 2027
NIHUS FederalResearch GrantFY2026ADPKDActin FilamentsActin-Binding ProteinActinsActomyosinAdult Polycystic Kidney DiseaseAutosomal Dominant Polycystic KidneyAutosomal Dominant Polycystic Kidney DiseaseBiomassCalcineurinCalciumCalcium Ion SignalingCalcium SignalingCalcium SpikesCalcium-Dependent Activator ProteinCalcium-Dependent RegulatorCalmodulinCell BodyCell CycleCell Division CycleCell FunctionCell Growth in NumberCell IsolationCell MultiplicationCell PhysiologyCell ProcessCell ProliferationCell SegregationCell SeparationCell Separation TechnologyCell SizeCell divisionCell membraneCellsCellular ExpansionCellular FunctionCellular GrowthCellular MatrixCellular MechanotransductionCellular PhysiologyCellular ProcessCellular ProliferationCollaborationsCytokinesisCytoplasmic DivisionCytoplasmic MembraneCytoskeletal SystemCytoskeletonDNA mutationDominant Polycystic Kidney DiseaseEndocytosisEnvironmentEvolutionFamilyFission YeastGeneralized GrowthGenesGenetic ChangeGenetic DiseasesGenetic ScreeningGenetic defectGenetic mutationGrowthHumanHuman GeneticsImageIn VitroIntracellular TransportIon ChannelIonic ChannelsIonsKidney DiseasesKinasesLeadLipidsMechanical Signal TransductionMechanosensory TransductionMediatingMembrane ChannelsMichiganMicrofilamentsMicrofluidicsModelingModern ManMolecularMorphogenesisMutationMyofilamentsMyosin IMyosin Type IMyosin Type VMyosin VNephropathyOsmosisOsmotic PressurePP2BPathway interactionsPatternPb elementPermeabilityPhosphodiesterase Activating FactorPhosphodiesterase Protein ActivatorPhosphotransferase GenePhosphotransferasesPlasma MembranePlayPolycystic KidneyPolycystic Kidney DiseasesProcessProtein Phosphatase-2BQuantitative MicroscopyRegulationRegulation of Cell SizeRenal DiseaseReproducibilityRoleS pombeS. pombeSchizosaccharomyces pombeSignal PathwaySignaling MoleculeStimulusStructureSubcellular ProcessTechniquesTennesseeTestingTissue GrowthTransphosphorylasesUniversitiesWorkYeastsautosomecell growthcell sortingconstrictiondaughter celldriving forcegenetic conditiongenetic disordergenome mutationheavy metal Pbheavy metal leadimage-based methodimagingimaging methodimaging modalityinnovateinnovationinnovativeintracellular skeletonkidney disorderloss of function mutationmechanical cuemechanical forcemechanical signalmechanosensingmechanotransductionmodel organismmorphogenetic processmultidisciplinarynovelontogenypatch clamppathwaypermissivenessplasmalemmapublic health relevancereconstitutereconstitutionrenal disorderresponsesocial rolesynergismµfluidic
Sign up free to applyApply link · pipeline · email alerts
— or —

Get email alerts for similar roles

Weekly digest · no password needed · unsubscribe any time

Full Description

The mechanism of mechanosensing by polycystins during cell growth
Cytokinesis is the last stage of cell division when two daughter cells separate, but it is equally important for the

transition to cell growth including cell size expansion. The mechanism regulating such a transition is poorly

understood. We identified the role of calcium and the polycystin channel Pkd2p in this process while studying

cytokinesis of the model organism fission yeast. Pkd2p is essential to regulate the cell size and it mediates

calcium influx. Polycystins are evolutionally conserved ion channels. Loss of function mutations of human

polycystins lead to the genetic disorder, Autosomal Polycystic Kidney Disorder (ADPKD). The cellular function

of this highly conserved family of channels is not well understood. This study will determine how Pkd2p and

calcium regulate the transition to cell growth.

Aim 1. Determine how the Hippo signaling pathways regulate Pkd2p. Our genetic screen has identified the

fission yeast Hippo pathways SIN and MOR as crucial for the regulation of Pkd2p. Both are highly conserved

kinase cascades that are essential for cell proliferation. SIN antagonizes Pkd2p activity, while MOR synergizes

with Pkd2p. However, the mechanism is unclear. We will 1) Determine how MOR and SIN regulate cellular

calcium during cytokinesis through calcium-imaging. 2) Determine how MOR and SIN regulate Pkd2p in cell size

expansion. 3) Determine how MOR promotes the cell cycle-dependent localization of Pkd2p. 4) Determine

whether Pkd2p is a direct substrate of the MOR kinase Orb6p. Aim 2. Determine how the Pkd2p channel is

activated. Pkd2 channel opens in response to mechanical force in vitro, but the mechanism is unclear. We will

test the proposal that Pkd2p is a channel sensitive to the force driving the yeast cell growth. We will 1) Determine

how Pkd2p regulates calcium when the cells are stimulated by external force. 2) Probe how Pkd2p senses

osmotic stimuli and the lipid environment in vitro through a collaboration with Allen Liu’s group (University of

Michigan). 3) Determine whether Pkd2p channel allows ions other than calcium to pass through, using patch

clamp, through a collaboration with Du Jianyang’s group (University of Tennessee). Aim 3 Determine how

Pkd2p regulates the actin re-organization during cytokinesis. Calcium can activate two highly conserved

molecules Cam1p and Ppb1p. We will determine how they contribute to the role of Pkd2p in cytokinesis. We will

determine 1) how Pkd2p regulates the Cam1p-dependent endocytosis during cytokinesis. 2) how Pkd2p

regulates the Cam1p-dependent intracellular transport. 3) how Pkd2p regulates the enzymatic activity of Ppb1p.

Through this study, we expect to uncover a novel cell size regulation pathway mediated by Pkd2p channel. We

will demonstrate how both internal signaling pathways and external environment play a vital role in activating

this channel in cytokinesis. We will employ novel imaging methods combined with innovative in vitro techniques

in our study. Our works shall help us better understand the cellular functions of the human polycystins.

Grant Number: 5R01GM144652-05
NIH Institute/Center: NIH

Principal Investigator: Qian Chen

Sign up free to get the apply link, save to pipeline, and set email alerts.

Sign up free →

Agency Plan

7-day free trial

Unlock procurement & grants

Upgrade to access active tenders from World Bank, UNDP, ADB and more — with email alerts and pipeline tracking.

$29.99 / month

  • 🔔Email alerts for new matching tenders
  • 🗂️Track tenders in your pipeline
  • 💰Filter by contract value
  • 📥Export results to CSV
  • 📌Save searches with one click
Start 7-day free trial →