grant

Dogs as a high fidelity, high throughput model to evaluate CAR-T cell function and dysfunction

Organization COLORADO STATE UNIVERSITYLocation FORT COLLINS, UNITED STATESPosted 15 Sept 2021Deadline 14 Sept 2026
NIHUS FederalResearch GrantFY2025Animal ModelAnimal Models and Related StudiesAnimalsAntibodiesAntigensB cell malignancyB lymphoid malignancyB lymphomaB-Cell LymphomasBackBar CodesBindingBiologyBiopsyBone SarcomaBp35Breast CarcinomaCAR T cell therapyCAR T cellsCAR T therapyCAR modified T cellsCAR-TCAR-TsCD20CD28CD28 geneCancer BiologyCancersCanine SpeciesCanis familiarisCell BodyCell FunctionCell PhysiologyCell ProcessCellsCellular FunctionCellular PhysiologyCellular ProcessCellular biologyCellular immunotherapyChemicalsChimera ProteinChimeric ProteinsCo-StimulatorCo-cultureCocultivationCocultureCoculture TechniquesComplementComplement ProteinsContracting OpportunitiesContractsCostimulatorDisease remissionDogsDogs MammalsDorsumDysfunctionELISAEngraftmentEnzyme-Linked Immunosorbent AssayEpidermal Thymocyte Activating FactorEthicsEvolutionFc ReceptorFunctional disorderFusion ProteinFutureGenerationsGeneticHealthHematologic CancerHematologic MalignanciesHematologic NeoplasmsHematological MalignanciesHematological NeoplasmsHematological TumorHematopoietic CancerHomeHumanIFN-GammaIFN-gIFN-γIFNGIFNγIL-2IL2 ProteinIVIS SpectrumCTIVIS imagingIVIS optical imagingIVIS spectral imagingIVIS spectrumIVIS systemImmuneImmune InterferonImmune systemImmunesImmunocompetentImmunodeficient MouseIn VitroInbreedingIncidenceIndividualInfusionInfusion proceduresInterferon GammaInterferon Type IIInterleukin 2Interleukin 2 PrecursorInterleukin IIInterleukin-2Interleukine 2Interleukine 2 PrecursorInterleukine IIKineticsLentiviral VectorLentivirus VectorLeu-16Lymphocyte Mitogenic FactorMHC ReceptorMS4A1MS4A1 geneMS4A2Major Histocompatibility Complex ReceptorMalignant Hematologic NeoplasmMalignant MelanomaMalignant NeoplasmsMalignant TumorMammary CarcinomaMeasurementMeasuresMelanomaMethodsMiceMice MammalsMitogenic FactorModelingModern ManMolecularMolecular InteractionMurineMusNeuroblastomaNucleotidesOsseous SarcomaOsteogenic SarcomaOsteosarcomaPatientsPh D studentPh D. studentPh. D. studentPh.D studentPh.D. studentPhD studentPhD. studentPhenotypePhysiopathologyProceduresProductionRNA SeqRNA sequencingRNAseqReceptor SignalingRefractoryRelapseRemissionResearchSamplingScientistSingle cell seqSkeletal SarcomaSolid NeoplasmSolid TumorSubcellular ProcessT cell growth factorT cell infiltrationT cells for CART-Cell Antigen ReceptorsT-Cell Growth FactorT-Cell Homing ReceptorsT-Cell ReceptorT-Cell Stimulating FactorT-Cell SubsetsT-CellsT-LymphocyteT-Lymphocyte SubsetsT44TestingThymocyte Stimulating FactorTrainingTranslatingTreatment EfficacyTumor AntigensTumor Cell LineTumor-Associated AntigenVeterinariansVideo MicroscopyVideomicrographyVideomicroscopyXenograft Modelanti-tumor effectantibody receptorantitumor effectbarcodecancer antigenscaninecanine animal modelcanine modelcareercell biologycell transductioncell-based immunotherapycellular transductionchimeric antigen T cell receptorchimeric antigen receptorchimeric antigen receptor (CAR) T cell therapychimeric antigen receptor (CAR) T cellschimeric antigen receptor Tchimeric antigen receptor T cell therapychimeric antigen receptor T cellschimeric antigen receptor T therapychimeric antigen receptor fusion protein T-cellschimeric antigen receptor modified T cellscomplement systemcomplementationcostdesigndesigningdetermine efficacydoctoral studentdog modeldomestic dogdriving forceefficacy analysisefficacy assessmentefficacy determinationefficacy evaluationefficacy examinationenzyme linked immunoassayethicalevaluate efficacyexamine efficacyhomeshypoimmunityimmune cell therapyimmune competentimmune deficiencyimmunodeficiencyimmunogenin vivoin vivo imaging systeminfusionsintervention efficacylFN-Gammamalignancymodel of animalmouse modelmurine modelneoplasm/cancernew approachesnovelnovel approachesnovel strategiesnovel strategyosteochondrosarcomaosteoid sarcomapathophysiologypre-clinicalpre-clinical efficacypreclinicalpreclinical efficacyrestraintsingle cell next generation sequencingsingle cell sequencingsuccesstherapeutic efficacytherapy efficacythymus derived lymphocytetimelinetraffickingtranscriptome sequencingtranscriptomic sequencingtransduced cellstranslational modeltumortumor growthtumor-specific antigenxenograft transplant modelxenotransplant model
Sign up free to applyApply link · pipeline · email alerts
— or —

Get email alerts for similar roles

Weekly digest · no password needed · unsubscribe any time

Full Description

Project Summary
This proposal aims to train a dual-degree, DVM-PhD student for a career as a lab animal veterinarian and independent

scientist. The research outlined in this proposal will develop a pre-clinical platform to evaluate CAR-T therapy in a canine

model. Chimeric antigen receptor (CAR)-T cells have induced up to 90% remission rates for treatment

relapsed/refractory B cell malignancies. While mice have been instrumental to CAR-T progress, CAR-T therapy for solid

tumors have been hampered by this inbred, immunodeficient model. Pet dogs are a higher fidelity translational model

due to their outbred genetics, intact immune system, high incidence of cancer, and similar cancer biology.

A CAR is a fusion protein comprised of a T cell receptor signaling domain, costimulatory domain, and an antibody based

binding domain. CARs are introduced to patients’ T cells ex vivo, enabling the T cells to directly recognize tumor antigen.

CAR-T cells are a “living therapy” wherein the efficacy of the treatment relies not only on the design of the CAR, but also

how the CAR-T cells are able to home to the tumor and elicit anti-tumor effects. The CAR helps T cells to “recognize” the

tumor, but the trafficking, persistence, and effector function of these cells relies heavily on intrinsic T cell biology. To

adequately assess CAR-T cell function in vivo, design of the CAR (Aim 1) and patient T cell biology (Aim 2) will be

evaluated.

Aim 1 – Determine optimal CAR design for targeting tumor associated antigens GD2, FolR1, and CD20. CAR constructs

will be designed for the tumor associated antigens GD2, FolR1, and CD20. These CARs will be introduced to primary

canine T cells via a lentiviral vector. The CAR-T cells will be evaluated for efficacy against antigen positive tumors by IFNγ

ELISA, IL-2 ELISA, and Incucyte live cell videomicroscopy. Each of these constructs will be tested with CAR costimulatory

domains 4-1BB and CD28. The CAR constructs with the strongest reactivity will be further evaluated with an NOD scid

gamma (NSG) mouse xenograft model, measuring tumor growth inhibition and CAR-T expansion in vivo.

Aim 2 – Determine which subset of CAR-T cells preferentially traffic and persist in the tumor in vivo. To evaluate the

respective contribution of CAR-T cell subsets to anti-tumor efficacy in vivo, semi-random nucleotide barcodes will be

added to the CAR constructs allowing for the tracking of clonal lineage during CAR-T production, infusion, and post-

engraftment in mice. Using single cell sequencing, clonal diversity of the CAR-T infusion product will be compared to

clonal diversity intratumorally. Subsets of CAR-T that preferentially home to and expand in the tumor will be identified.

Together, these aims will set the basis for future studies of CAR-T therapy in a canine model. Aim 1 will provide a

candidate CAR construct to be evaluated in a canine model. Aim 2 will provide a method for understanding how CAR-T

cells traffic to and persist within a tumor in vivo. This platform will be used to screen and refine novel approaches to

CAR-T therapy in a high-fidelity, high-throughput animal model.

Grant Number: 5F31CA265165-05
NIH Institute/Center: NIH

Principal Investigator: Samuel Brill

Sign up free to get the apply link, save to pipeline, and set email alerts.

Sign up free →

Agency Plan

7-day free trial

Unlock procurement & grants

Upgrade to access active tenders from World Bank, UNDP, ADB and more — with email alerts and pipeline tracking.

$29.99 / month

  • 🔔Email alerts for new matching tenders
  • 🗂️Track tenders in your pipeline
  • 💰Filter by contract value
  • 📥Export results to CSV
  • 📌Save searches with one click
Start 7-day free trial →