grant

Avian-inspired Regenerative Therapies for Hearing Loss

Organization STANFORD UNIVERSITYLocation STANFORD, UNITED STATESPosted 1 Mar 2024Deadline 28 Feb 2027
NIHUS FederalResearch GrantFY202621+ years oldAAV vectorAAV-based vectorATAC sequencingATAC-seqATACseqATF-3ATF3AcuteAddressAdeno-Associated VirusesAdultAdult HumanAdvanced DevelopmentAffectAssay for Transposase-Accessible Chromatin using sequencingAttenuatedAuditoryAuditory systemAvesAvianBasal Transcription FactorBasal transcription factor genesBirdsCell BodyCell CycleCell DeathCell Division CycleCell Growth in NumberCell MultiplicationCell ProliferationCellsCellular ProliferationCellular injuryChickensChronicCochleaCochlear OrganCorti CellCortis OrganDataData AnalysesData AnalysisData SetDependoparvovirusDependovirusDevelopmentEGF ReceptorEGFRERBB ProteinEffectivenessEmploymentEnsureEpidermal Growth Factor ReceptorEpidermal Growth Factor Receptor KinaseEpidermal Growth Factor Receptor Protein-Tyrosine KinaseEpidermal Growth Factor-Urogastrone ReceptorsEpigeneticEpigenetic ChangeEpigenetic MechanismEpigenetic ProcessExtracellular Signal-Regulated Kinase GeneFOS-Like Antigen 2FOSL2FOSL2 geneFRA2Fos-Like Antigen 2 GeneFra-2 proteinGallus domesticusGallus gallusGallus gallus domesticusGene DeliveryGene ExpressionGene TranscriptionGene TransferGeneral Transcription Factor GeneGeneral Transcription FactorsGenesGenetic TranscriptionGoalsHER1Hair CellsHearingHearing LossHumanHypoacusesHypoacusisIndividualInjectionsInner Hair CellsInner ear hair cellsLightLong-Term EffectsMAP Kinase GeneMAPKMMPsMYO7AMYO7A geneMYO7A gene productMammaliaMammalsMatrix MetalloproteinasesMeasuresMediatingMethodsMiceMice MammalsMissionMitogen-Activated Protein Kinase GeneModelingModern ManMolecularMolecular FingerprintingMolecular ProfilingMurineMusNational Institutes of HealthNatural regenerationNatureOrgan of CortiOutcomes ResearchOuter Hair CellsPathway interactionsPatientsPhotoradiationProliferatingProliferation MarkerR-Series Research ProjectsR01 MechanismR01 ProgramRNA ExpressionRecombinant adeno-associated virusRecombinant adeno-associated virus (rAAV)RecoveryRegenerationRegenerative capacityRegenerative pathwayRegenerative responseResearchResearch GrantsResearch Project GrantsResearch ProjectsResolutionS PeriodS phaseSensory HairSignaling Factor Proto-OncogeneSignaling Pathway GeneSignaling ProteinSingle-Nucleus SequencingSpecific qualifier valueSpecifiedSpiral OrganSpiral Organ of CortiStat3 Signaling PathwayStatistical MethodsSupporting CellSynthesis PeriodSynthesis PhaseTGF-alpha ReceptorTechniquesTherapeuticTherapeutic InterventionTimeTranscriptionTranscription Factor Proto-OncogeneTranscription factor genesTransforming Growth Factor alpha ReceptorUnited States National Institutes of HealthUrogastrone ReceptorViral VectorVirusWorld Health Organizationactivating transcription factor 3adeno associated virus groupadeno-associated viral vectoradeno-associated virus vectoradulthoodagedassay for transposase accessible chromatin followed by sequencingassay for transposase accessible chromatin seqassay for transposase accessible chromatin sequencingassay for transposase-accessible chromatin with sequencingattenuateattenuatesc-erbB-1c-erbB-1 Proteincell damagecell fate specificationcell injurycellular damagecomparativedamage to cellsdata interpretationdeafdeafeneddevelop therapydevelopmentaldisabilitydysfunctional hearingear hair celleffective therapyeffective treatmentepigeneticallyerbB-1erbB-1 Proto-Oncogene ProteinerbBlfos-related antigen-2hair cell regenerationhearing challengedhearing defecthearing deficienthearing deficithearing difficultyhearing dysfunctionhearing impairmenthearing loss therapyhearing loss treatmenthearing restorationinducible expressioninducible gene expressioninjury to cellsinnovateinnovationinnovativeinsightintervention developmentintervention therapymRNA Expressionmolecular profilemolecular signaturemultiomicsmultiple omicsmyosin VIIanecrocytosisneonatal micenew drug treatmentsnew drugsnew pharmacological therapeuticnew therapeuticsnew therapynext generation therapeuticsnovel drug treatmentsnovel drugsnovel pharmaco-therapeuticnovel pharmacological therapeuticnovel therapeuticsnovel therapypanomicspathwaypermissivenesspharmacologicprestinprestin (motor protein), ratpreventpreventingprofound hearing lossproliferation capabilityproliferation capacityproliferation potentialproliferative capabilityproliferative capacityproliferative potentialpromoterpromotorproto-oncogene protein c-erbB-1rAAVrat Pres proteinrat prestin proteinrecombinant AAVregenerateregeneration abilityregeneration based therapyregeneration capacityregeneration pathwayregeneration potentialregeneration responseregeneration therapyregenerativeregenerative potentialregenerative therapeuticsregenerative therapyresolutionsrestore hearingsNuc-SeqscRNA sequencingscRNA-seqsingle cell RNA-seqsingle cell RNAseqsingle cell expression profilingsingle cell transcriptomic profilingsingle nucleus RNA-sequencingsingle nucleus seqsingle-cell RNA sequencingsingle-nucleus RNA-seqsnRNA sequencingsnRNA-seqstatistic methodstargeted drug therapytargeted drug treatmentstargeted therapeutictargeted therapeutic agentstargeted therapytargeted treatmenttherapeutic candidatetherapy developmenttranscription factortranscriptomicstreatment developmenttreatment for hearing loss
Sign up free to applyApply link · pipeline · email alerts
— or —

Get email alerts for similar roles

Weekly digest · no password needed · unsubscribe any time

Full Description

PROJECT SUMMARY
Hearing loss is a prevalent condition affecting millions of individuals worldwide, primarily caused by the

irreversible loss of auditory hair cells. While non-mammalian species possess the remarkable ability to

regenerate hair cells, mammals, including humans, lack this regenerative capacity. Therefore, understanding

the regenerative potential of hair cells in mammals is crucial for developing effective therapies to restore hearing.

The objective of this project is to decipher the mechanisms for inducing S-phase entry in adult mammalian

supporting cells and investigate their regenerative potential for sensory hair cell regeneration in the auditory

system.

In AIM 1, the study will align transcriptomic and epigenetic data at single-cell resolution to establish a baseline

profile of supporting cells before, during, and after hair cell loss. The analysis will identify the molecular signatures

associated with the quiescent state of supporting cells in mammals and explore the influence of epigenetic factors

on the regenerative incapability of supporting cells and their differentiation into functional hair cells. Comparative

analysis with chicken datasets will refine strategies for inducing cell cycle re-entry in supporting cells. AIM 2

focuses on developing a strategy to specifically target adult supporting cells after acute and chronic hair cell

damage. The study will employ an inducible gene expression strategy in adult supporting cells using adeno-

associated virus (AAV)-mediated gene transfer. AIM 3 investigates the possibility to induce division in mature

supporting cells and hair cell fate specification using a co-misexpression approach with multiple transcription

factors.

The project will utilize innovative techniques such as multi-omics low-depth single-cell RNA-seq and single-

nucleus ATAC-seq to characterize supporting cells at different time points post-hair cell insult. The employment

of Fbxo2VHC/WT mice and inducible gene expression strategies using AAV-mediated gene transfer will ensure

accurate representation and temporal control of gene expression in supporting cells. The use of various controls

and statistical methods will ensure robust data analysis and mitigate technical biases.

The outcomes of this research will shed light on the molecular and epigenetic identity of supporting cells, identify

potential targets for therapeutic interventions, and refine strategies for inducing cell cycle re-entry and hair cell

regeneration. Ultimately, this project aims to contribute to the development of regenerative therapies for hearing

loss, providing hope for millions of individuals worldwide.

Grant Number: 5R21DC021755-03
NIH Institute/Center: NIH

Principal Investigator: Nesrine Benkafadar

Sign up free to get the apply link, save to pipeline, and set email alerts.

Sign up free →

Agency Plan

7-day free trial

Unlock procurement & grants

Upgrade to access active tenders from World Bank, UNDP, ADB and more — with email alerts and pipeline tracking.

$29.99 / month

  • 🔔Email alerts for new matching tenders
  • 🗂️Track tenders in your pipeline
  • 💰Filter by contract value
  • 📥Export results to CSV
  • 📌Save searches with one click
Start 7-day free trial →